PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_8.54
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family FAR1
Protein Properties Length: 235aa    MW: 26528.9 Da    PI: 5.8334
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_8.54genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR186.15.4e-2768157190
                        FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtklel 83 
                                 kfY eYA++vGF vr+ + ++s  +g++  r++ C+k+g++ ++k +    +++r++ r gCka++ vk+ek+gkw+vt++++
  evm.model.supercontig_8.54  68 KFYVEYARRVGFVVRVMQRRRSGIDGRTLARRLGCNKQGFSPNQKGALGPDKKPRPSAREGCKATILVKMEKSGKWVVTRFVK 150
                                 6********************************************************************************** PP

                        FAR1  84 eHnHela 90 
                                 +HnH+l+
  evm.model.supercontig_8.54 151 DHNHPLV 157
                                 *****96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.5E-2568157IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MQVDLDKEEV AADSSIEEKA YELESGEGDT ERGEIGKSEG GEVGELERDE VLEPYVGMEF  60
ESEDDARKFY VEYARRVGFV VRVMQRRRSG IDGRTLARRL GCNKQGFSPN QKGALGPDKK  120
PRPSAREGCK ATILVKMEKS GKWVVTRFVK DHNHPLVVTA NGFSTSGDKD KKIKELSMEL  180
AHQEQLCAAY REKLLSFMNN VEEQTEELSS KIQVIVDNVR KLESEMLRHS QSRR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007049566.11e-125Far-red impaired responsive family protein isoform 2
TrEMBLA0A061DUS51e-125A0A061DUS5_THECC; Far-red impaired responsive family protein isoform 2
STRINGGLYMA18G24443.11e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39182855
Representative plantOGRP3376727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12850.11e-76FAR1 family protein